Anti PTPN14 pAb (ATL-HPA053864 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA053864-100

Protein Description: protein tyrosine phosphatase, non-receptor type 14
Gene Name: PTPN14
Alternative Gene Name: PEZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026604: 82%, ENSRNOG00000003407: 83%
Entrez Gene ID: 5784
Uniprot ID: Q15678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
• Gene Sequence: PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
• Gene ID - Mouse: ENSMUSG00000026604
• Gene ID - Rat: ENSRNOG00000003407
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPN14 pAb (ATL-HPA053864 w/enhanced validation) – 2 Found

Szalmás, Anita; Tomaić, Vjekoslav; Basukala, Om; Massimi, Paola; Mittal, Suruchi; Kónya, József; Banks, Lawrence. The PTPN14 Tumor Suppressor Is a Degradation Target of Human Papillomavirus E7. Journal Of Virology. 2017;91(7) 

Wu, Chien-Ting; Lidsky, Peter V; Xiao, Yinghong; Cheng, Ran; Lee, Ivan T; Nakayama, Tsuguhisa; Jiang, Sizun; He, Wei; Demeter, Janos; Knight, Miguel G; Turn, Rachel E; Rojas-Hernandez, Laura S; Ye, Chengjin; Chiem, Kevin; Shon, Judy; Martinez-Sobrido, Luis; Bertozzi, Carolyn R; Nolan, Garry P; Nayak, Jayakar V; Milla, Carlos; Andino, Raul; Jackson, Peter K. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming. Cell. 2023;186(1):112-130.e20.