Anti PTOV1 pAb (ATL-HPA075125)

Atlas Antibodies

SKU:
ATL-HPA075125-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: prostate tumor overexpressed 1
Gene Name: PTOV1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038502: 100%, ENSRNOG00000020358: 100%
Entrez Gene ID: 53635
Uniprot ID: Q86YD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRT
Gene Sequence WSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRT
Gene ID - Mouse ENSMUSG00000038502
Gene ID - Rat ENSRNOG00000020358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PTOV1 pAb (ATL-HPA075125)
Datasheet Anti PTOV1 pAb (ATL-HPA075125) Datasheet (External Link)
Vendor Page Anti PTOV1 pAb (ATL-HPA075125) at Atlas Antibodies

Documents & Links for Anti PTOV1 pAb (ATL-HPA075125)
Datasheet Anti PTOV1 pAb (ATL-HPA075125) Datasheet (External Link)
Vendor Page Anti PTOV1 pAb (ATL-HPA075125)