Anti PTN pAb (ATL-HPA073913)

Atlas Antibodies

Catalog No.:
ATL-HPA073913-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: pleiotrophin
Gene Name: PTN
Alternative Gene Name: HBGF8, HBNF, NEGF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029838: 98%, ENSRNOG00000011946: 98%
Entrez Gene ID: 5764
Uniprot ID: P21246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK
Gene Sequence KQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKK
Gene ID - Mouse ENSMUSG00000029838
Gene ID - Rat ENSRNOG00000011946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTN pAb (ATL-HPA073913)
Datasheet Anti PTN pAb (ATL-HPA073913) Datasheet (External Link)
Vendor Page Anti PTN pAb (ATL-HPA073913) at Atlas Antibodies

Documents & Links for Anti PTN pAb (ATL-HPA073913)
Datasheet Anti PTN pAb (ATL-HPA073913) Datasheet (External Link)
Vendor Page Anti PTN pAb (ATL-HPA073913)