Anti PTH pAb (ATL-HPA048540 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048540-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: parathyroid hormone
Gene Name: PTH
Alternative Gene Name: PTH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059077: 69%, ENSRNOG00000014318: 73%
Entrez Gene ID: 5741
Uniprot ID: P01270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK
Gene Sequence KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK
Gene ID - Mouse ENSMUSG00000059077
Gene ID - Rat ENSRNOG00000014318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTH pAb (ATL-HPA048540 w/enhanced validation)
Datasheet Anti PTH pAb (ATL-HPA048540 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTH pAb (ATL-HPA048540 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PTH pAb (ATL-HPA048540 w/enhanced validation)
Datasheet Anti PTH pAb (ATL-HPA048540 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTH pAb (ATL-HPA048540 w/enhanced validation)