Anti PTH pAb (ATL-HPA048540 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048540-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PTH
Alternative Gene Name: PTH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059077: 69%, ENSRNOG00000014318: 73%
Entrez Gene ID: 5741
Uniprot ID: P01270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK |
Gene Sequence | KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK |
Gene ID - Mouse | ENSMUSG00000059077 |
Gene ID - Rat | ENSRNOG00000014318 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTH pAb (ATL-HPA048540 w/enhanced validation) | |
Datasheet | Anti PTH pAb (ATL-HPA048540 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTH pAb (ATL-HPA048540 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PTH pAb (ATL-HPA048540 w/enhanced validation) | |
Datasheet | Anti PTH pAb (ATL-HPA048540 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PTH pAb (ATL-HPA048540 w/enhanced validation) |