Anti PTGS2 pAb (ATL-HPA001335)

Atlas Antibodies

Catalog No.: ATL-HPA001335-25

Protein Description: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Gene Name: PTGS2
Alternative Gene Name: COX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032487: 88%, ENSRNOG00000002525: 88%
Entrez Gene ID: 5743
Uniprot ID: P35354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE
• Gene Sequence: RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE
• Gene ID - Mouse: ENSMUSG00000032487
• Gene ID - Rat: ENSRNOG00000002525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTGS2 pAb (ATL-HPA001335) – 5 Found

Charo, Chantale; Holla, Vijaykumar; Arumugam, Thiruvengadam; Hwang, Rosa; Yang, Peiying; Dubois, Raymond N; Menter, David G; Logsdon, Craig D; Ramachandran, Vijaya. Prostaglandin E2 regulates pancreatic stellate cell activity via the EP4 receptor. Pancreas. 2013;42(3):467-74. 

Hamsten, Carl; Wiklundh, Emil; Grönlund, Hans; Schwenk, Jochen M; Uhlén, Mathias; Eklund, Anders; Nilsson, Peter; Grunewald, Johan; Häggmark-Månberg, Anna. Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients. Respiratory Research. 2016;17(1):69. 

Ayiomamitis, Georgios D; Notas, George; Vasilakaki, Thivi; Tsavari, Aikaterini; Vederaki, Styliani; Theodosopoulos, Theodosis; Kouroumalis, Elias; Zaravinos, Apostolos. Understanding the Interplay between COX-2 and hTERT in Colorectal Cancer Using a Multi-Omics Analysis. Cancers. 2019;11(10) 

Otsuki, Yuji; Yamasaki, Juntaro; Suina, Kentaro; Okazaki, Shogo; Koike, Naoyoshi; Saya, Hideyuki; Nagano, Osamu. Vasodilator oxyfedrine inhibits aldehyde metabolism and thereby sensitizes cancer cells to xCT-targeted therapy. Cancer Science. 2020;111(1):127-136. 

Martisova, Andrea; Sommerova, Lucia; Krejci, Adam; Selingerova, Iveta; Kolarova, Tamara; Zavadil Kokas, Filip; Holanek, Milos; Podhorec, Jan; Kazda, Tomas; Hrstka, Roman. Identification of AGR2 Gene-Specific Expression Patterns Associated with Epithelial-Mesenchymal Transition. International Journal Of Molecular Sciences. 2022;23(18)