Anti PTGS1 pAb (ATL-HPA002834 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002834-25

Protein Description: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Gene Name: PTGS1
Alternative Gene Name: COX1, PGHS-1, PTGHS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047250: 93%, ENSRNOG00000007415: 90%
Entrez Gene ID: 5742
Uniprot ID: P23219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
• Gene Sequence: MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
• Gene ID - Mouse: ENSMUSG00000047250
• Gene ID - Rat: ENSRNOG00000007415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTGS1 pAb (ATL-HPA002834 w/enhanced validation) – 4 Found

Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. 

Ayiomamitis, Georgios D; Notas, George; Vasilakaki, Thivi; Tsavari, Aikaterini; Vederaki, Styliani; Theodosopoulos, Theodosis; Kouroumalis, Elias; Zaravinos, Apostolos. Understanding the Interplay between COX-2 and hTERT in Colorectal Cancer Using a Multi-Omics Analysis. Cancers. 2019;11(10) 

Shao, Wanting; Kuhn, Christina; Mayr, Doris; Ditsch, Nina; Kailuwait, Magdalena; Wolf, Verena; Harbeck, Nadia; Mahner, Sven; Jeschke, Udo; Cavaillès, Vincent; Sixou, Sophie. Cytoplasmic PPARγ is a marker of poor prognosis in patients with Cox-1 negative primary breast cancers. Journal Of Translational Medicine. 2020;18(1):94. 

Sparreman Mikus, Maria; Kolmert, Johan; Andersson, Lars I; Östling, Jörgen; Knowles, Richard G; Gómez, Cristina; Ericsson, Magnus; Thörngren, John-Olof; Emami Khoonsari, Payam; Dahlén, Barbro; Kupczyk, Maciej; De Meulder, Bertrand; Auffray, Charles; Bakke, Per S; Beghe, Bianca; Bel, Elisabeth H; Caruso, Massimo; Chanez, Pascal; Chawes, Bo; Fowler, Stephen J; Gaga, Mina; Geiser, Thomas; Gjomarkaj, Mark; Horváth, Ildikó; Howarth, Peter H; Johnston, Sebastian L; Joos, Guy; Krug, Norbert; Montuschi, Paolo; Musial, Jacek; Niżankowska-Mogilnicka, Ewa; Olsson, Henric K; Papi, Alberto; Rabe, Klaus F; Sandström, Thomas; Shaw, Dominick E; Siafakas, Nikolaos M; Uhlén, Mathias; Riley, John H; Bates, Stewart; Middelveld, Roelinde J M; Wheelock, Craig E; Chung, Kian Fan; Adcock, Ian M; Sterk, Peter J; Djukanovic, Ratko; Nilsson, Peter; Dahlén, Sven-Erik; James, Anna. Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammation. The European Respiratory Journal. 2022;59(2)