Anti PTGIS pAb (ATL-HPA052244)

Atlas Antibodies

Catalog No.:
ATL-HPA052244-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: prostaglandin I2 synthase
Gene Name: PTGIS
Alternative Gene Name: CYP8A1, PGIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017969: 82%, ENSRNOG00000008245: 75%
Entrez Gene ID: 5740
Uniprot ID: Q16647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR
Gene Sequence GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR
Gene ID - Mouse ENSMUSG00000017969
Gene ID - Rat ENSRNOG00000008245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTGIS pAb (ATL-HPA052244)
Datasheet Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link)
Vendor Page Anti PTGIS pAb (ATL-HPA052244) at Atlas Antibodies

Documents & Links for Anti PTGIS pAb (ATL-HPA052244)
Datasheet Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link)
Vendor Page Anti PTGIS pAb (ATL-HPA052244)