Anti PTGIS pAb (ATL-HPA052244)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052244-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PTGIS
Alternative Gene Name: CYP8A1, PGIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017969: 82%, ENSRNOG00000008245: 75%
Entrez Gene ID: 5740
Uniprot ID: Q16647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR |
| Gene Sequence | GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR |
| Gene ID - Mouse | ENSMUSG00000017969 |
| Gene ID - Rat | ENSRNOG00000008245 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTGIS pAb (ATL-HPA052244) | |
| Datasheet | Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link) |
| Vendor Page | Anti PTGIS pAb (ATL-HPA052244) at Atlas Antibodies |
| Documents & Links for Anti PTGIS pAb (ATL-HPA052244) | |
| Datasheet | Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link) |
| Vendor Page | Anti PTGIS pAb (ATL-HPA052244) |