Anti PTGIS pAb (ATL-HPA052244)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052244-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PTGIS
Alternative Gene Name: CYP8A1, PGIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017969: 82%, ENSRNOG00000008245: 75%
Entrez Gene ID: 5740
Uniprot ID: Q16647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR |
Gene Sequence | GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR |
Gene ID - Mouse | ENSMUSG00000017969 |
Gene ID - Rat | ENSRNOG00000008245 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PTGIS pAb (ATL-HPA052244) | |
Datasheet | Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link) |
Vendor Page | Anti PTGIS pAb (ATL-HPA052244) at Atlas Antibodies |
Documents & Links for Anti PTGIS pAb (ATL-HPA052244) | |
Datasheet | Anti PTGIS pAb (ATL-HPA052244) Datasheet (External Link) |
Vendor Page | Anti PTGIS pAb (ATL-HPA052244) |