Anti PTGES2 pAb (ATL-HPA020733)

Atlas Antibodies

Catalog No.: ATL-HPA020733-100

Protein Description: prostaglandin E synthase 2
Gene Name: PTGES2
Alternative Gene Name: C9orf15, FLJ14038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026820: 89%, ENSRNOG00000014050: 91%
Entrez Gene ID: 80142
Uniprot ID: Q9H7Z7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQ
• Gene Sequence: AQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQ
• Gene ID - Mouse: ENSMUSG00000026820
• Gene ID - Rat: ENSRNOG00000014050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.