Anti PTEN pAb (ATL-HPA031335)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031335-100
- Shipping:
- Calculated at Checkout
$520.00
Gene Name: PTEN
Alternative Gene Name: BZS, MHAM, MMAC1, PTEN1, TEP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013663: 100%, ENSRNOG00000020723: 100%
Entrez Gene ID: 5728
Uniprot ID: P60484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT |
| Gene Sequence | VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT |
| Gene ID - Mouse | ENSMUSG00000013663 |
| Gene ID - Rat | ENSRNOG00000020723 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTEN pAb (ATL-HPA031335) | |
| Datasheet | Anti PTEN pAb (ATL-HPA031335) Datasheet (External Link) |
| Vendor Page | Anti PTEN pAb (ATL-HPA031335) at Atlas Antibodies |
| Documents & Links for Anti PTEN pAb (ATL-HPA031335) | |
| Datasheet | Anti PTEN pAb (ATL-HPA031335) Datasheet (External Link) |
| Vendor Page | Anti PTEN pAb (ATL-HPA031335) |