Anti PTEN pAb (ATL-HPA031335)

Atlas Antibodies

Catalog No.: ATL-HPA031335-100

Protein Description: phosphatase and tensin homolog
Gene Name: PTEN
Alternative Gene Name: BZS, MHAM, MMAC1, PTEN1, TEP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013663: 100%, ENSRNOG00000020723: 100%
Entrez Gene ID: 5728
Uniprot ID: P60484
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
• Gene Sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
• Gene ID - Mouse: ENSMUSG00000013663
• Gene ID - Rat: ENSRNOG00000020723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.