Anti PTCD1 pAb (ATL-HPA047679)

Atlas Antibodies

Catalog No.: ATL-HPA047679-25

Protein Description: pentatricopeptide repeat domain 1
Gene Name: PTCD1
Alternative Gene Name: KIAA0632
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 78%, ENSRNOG00000000987: 77%
Entrez Gene ID: 26024
Uniprot ID: O75127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLQLLTDMKKSQVTPNTHIYSALINAAIRKLNYTYLISILKDMKQNRVPVNEVVIRQLEFAAQYPPTFDRYQGKNTYLEKIDGFRAYYKQWLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCA
• Gene Sequence: GLQLLTDMKKSQVTPNTHIYSALINAAIRKLNYTYLISILKDMKQNRVPVNEVVIRQLEFAAQYPPTFDRYQGKNTYLEKIDGFRAYYKQWLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCA
• Gene ID - Mouse: ENSMUSG00000029624
• Gene ID - Rat: ENSRNOG00000000987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTCD1 pAb (ATL-HPA047679) – 1 Found

Fleck, Daniel; Phu, Lilian; Verschueren, Erik; Hinkle, Trent; Reichelt, Mike; Bhangale, Tushar; Haley, Benjamin; Wang, Yuanyuan; Graham, Robert; Kirkpatrick, Donald S; Sheng, Morgan; Bingol, Baris. PTCD1 Is Required for Mitochondrial Oxidative-Phosphorylation: Possible Genetic Association with Alzheimer's Disease. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(24):4636-4656.