Anti PTCD1 pAb (ATL-HPA047679)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047679-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PTCD1
Alternative Gene Name: KIAA0632
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 78%, ENSRNOG00000000987: 77%
Entrez Gene ID: 26024
Uniprot ID: O75127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLQLLTDMKKSQVTPNTHIYSALINAAIRKLNYTYLISILKDMKQNRVPVNEVVIRQLEFAAQYPPTFDRYQGKNTYLEKIDGFRAYYKQWLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCA |
| Gene Sequence | GLQLLTDMKKSQVTPNTHIYSALINAAIRKLNYTYLISILKDMKQNRVPVNEVVIRQLEFAAQYPPTFDRYQGKNTYLEKIDGFRAYYKQWLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCA |
| Gene ID - Mouse | ENSMUSG00000029624 |
| Gene ID - Rat | ENSRNOG00000000987 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTCD1 pAb (ATL-HPA047679) | |
| Datasheet | Anti PTCD1 pAb (ATL-HPA047679) Datasheet (External Link) |
| Vendor Page | Anti PTCD1 pAb (ATL-HPA047679) at Atlas Antibodies |
| Documents & Links for Anti PTCD1 pAb (ATL-HPA047679) | |
| Datasheet | Anti PTCD1 pAb (ATL-HPA047679) Datasheet (External Link) |
| Vendor Page | Anti PTCD1 pAb (ATL-HPA047679) |
| Citations for Anti PTCD1 pAb (ATL-HPA047679) – 1 Found |
| Fleck, Daniel; Phu, Lilian; Verschueren, Erik; Hinkle, Trent; Reichelt, Mike; Bhangale, Tushar; Haley, Benjamin; Wang, Yuanyuan; Graham, Robert; Kirkpatrick, Donald S; Sheng, Morgan; Bingol, Baris. PTCD1 Is Required for Mitochondrial Oxidative-Phosphorylation: Possible Genetic Association with Alzheimer's Disease. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(24):4636-4656. PubMed |