Anti PTCD1 pAb (ATL-HPA020106 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020106-25

Protein Description: pentatricopeptide repeat domain 1
Gene Name: PTCD1
Alternative Gene Name: KIAA0632
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 76%, ENSRNOG00000000987: 80%
Entrez Gene ID: 26024
Uniprot ID: O75127
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
• Gene Sequence: PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
• Gene ID - Mouse: ENSMUSG00000029624
• Gene ID - Rat: ENSRNOG00000000987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTCD1 pAb (ATL-HPA020106 w/enhanced validation) – 2 Found

Sanchez, Maria I G Lopez; Shearwood, Anne-Marie J; Chia, Tiongsun; Davies, Stefan M K; Rackham, Oliver; Filipovska, Aleksandra. Estrogen-mediated regulation of mitochondrial gene expression. Molecular Endocrinology (Baltimore, Md.). 2015;29(1):14-27. 

Fleck, Daniel; Phu, Lilian; Verschueren, Erik; Hinkle, Trent; Reichelt, Mike; Bhangale, Tushar; Haley, Benjamin; Wang, Yuanyuan; Graham, Robert; Kirkpatrick, Donald S; Sheng, Morgan; Bingol, Baris. PTCD1 Is Required for Mitochondrial Oxidative-Phosphorylation: Possible Genetic Association with Alzheimer's Disease. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(24):4636-4656.