Anti PSMG4 pAb (ATL-HPA074376)

Atlas Antibodies

Catalog No.:
ATL-HPA074376-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proteasome assembly chaperone 4
Gene Name: PSMG4
Alternative Gene Name: C6orf86, PAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071451: 95%, ENSRNOG00000039265: 95%
Entrez Gene ID: 389362
Uniprot ID: Q5JS54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT
Gene Sequence DVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDT
Gene ID - Mouse ENSMUSG00000071451
Gene ID - Rat ENSRNOG00000039265
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMG4 pAb (ATL-HPA074376)
Datasheet Anti PSMG4 pAb (ATL-HPA074376) Datasheet (External Link)
Vendor Page Anti PSMG4 pAb (ATL-HPA074376) at Atlas Antibodies

Documents & Links for Anti PSMG4 pAb (ATL-HPA074376)
Datasheet Anti PSMG4 pAb (ATL-HPA074376) Datasheet (External Link)
Vendor Page Anti PSMG4 pAb (ATL-HPA074376)