Anti PSME2 pAb (ATL-HPA062661)

Atlas Antibodies

Catalog No.:
ATL-HPA062661-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proteasome activator subunit 2
Gene Name: PSME2
Alternative Gene Name: PA28beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079197: 93%, ENSRNOG00000019246: 90%
Entrez Gene ID: 5721
Uniprot ID: Q9UL46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Gene Sequence IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Gene ID - Mouse ENSMUSG00000079197
Gene ID - Rat ENSRNOG00000019246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSME2 pAb (ATL-HPA062661)
Datasheet Anti PSME2 pAb (ATL-HPA062661) Datasheet (External Link)
Vendor Page Anti PSME2 pAb (ATL-HPA062661) at Atlas Antibodies

Documents & Links for Anti PSME2 pAb (ATL-HPA062661)
Datasheet Anti PSME2 pAb (ATL-HPA062661) Datasheet (External Link)
Vendor Page Anti PSME2 pAb (ATL-HPA062661)