Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062363-25
  • Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-PSMD2 antibody. Corresponding PSMD2 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: proteasome 26S subunit, non-ATPase 2
Gene Name: PSMD2
Alternative Gene Name: MGC14274, P97, Rpn1, S2, TRAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006998: 100%, ENSRNOG00000001719: 100%
Entrez Gene ID: 5708
Uniprot ID: Q13200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
Gene Sequence EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
Gene ID - Mouse ENSMUSG00000006998
Gene ID - Rat ENSRNOG00000001719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation)
Datasheet Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation)
Datasheet Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMD2 pAb (ATL-HPA062363 w/enhanced validation)