Anti PSMD11 pAb (ATL-HPA067433)

Atlas Antibodies

Catalog No.:
ATL-HPA067433-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: proteasome 26S subunit, non-ATPase 11
Gene Name: PSMD11
Alternative Gene Name: MGC3844, p44.5, Rpn6, S9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017428: 100%, ENSRNOG00000005538: 100%
Entrez Gene ID: 5717
Uniprot ID: O00231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY
Gene Sequence AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY
Gene ID - Mouse ENSMUSG00000017428
Gene ID - Rat ENSRNOG00000005538
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMD11 pAb (ATL-HPA067433)
Datasheet Anti PSMD11 pAb (ATL-HPA067433) Datasheet (External Link)
Vendor Page Anti PSMD11 pAb (ATL-HPA067433) at Atlas Antibodies

Documents & Links for Anti PSMD11 pAb (ATL-HPA067433)
Datasheet Anti PSMD11 pAb (ATL-HPA067433) Datasheet (External Link)
Vendor Page Anti PSMD11 pAb (ATL-HPA067433)