Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064293-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PSMC5
Alternative Gene Name: p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020708: 100%, ENSRNOG00000010038: 100%
Entrez Gene ID: 5705
Uniprot ID: P62195
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
| Gene Sequence | VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD |
| Gene ID - Mouse | ENSMUSG00000020708 |
| Gene ID - Rat | ENSRNOG00000010038 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) | |
| Datasheet | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) | |
| Datasheet | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSMC5 pAb (ATL-HPA064293 w/enhanced validation) |