Anti PSMC2 pAb (ATL-HPA049621)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049621-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PSMC2
Alternative Gene Name: MSS1, Nbla10058, S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028932: 100%, ENSRNOG00000012026: 100%
Entrez Gene ID: 5701
Uniprot ID: P35998
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV |
Gene Sequence | KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV |
Gene ID - Mouse | ENSMUSG00000028932 |
Gene ID - Rat | ENSRNOG00000012026 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMC2 pAb (ATL-HPA049621) | |
Datasheet | Anti PSMC2 pAb (ATL-HPA049621) Datasheet (External Link) |
Vendor Page | Anti PSMC2 pAb (ATL-HPA049621) at Atlas Antibodies |
Documents & Links for Anti PSMC2 pAb (ATL-HPA049621) | |
Datasheet | Anti PSMC2 pAb (ATL-HPA049621) Datasheet (External Link) |
Vendor Page | Anti PSMC2 pAb (ATL-HPA049621) |