Anti PSMC2 pAb (ATL-HPA019238 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019238-25

Protein Description: proteasome (prosome, macropain) 26S subunit, ATPase, 2
Gene Name: PSMC2
Alternative Gene Name: MSS1, Nbla10058, S7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028932: 99%, ENSRNOG00000012026: 100%
Entrez Gene ID: 5701
Uniprot ID: P35998
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
• Gene Sequence: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
• Gene ID - Mouse: ENSMUSG00000028932
• Gene ID - Rat: ENSRNOG00000012026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMC2 pAb (ATL-HPA019238 w/enhanced validation) – 3 Found

Guan, Yibing; Xu, Fangshi; Wang, Yiyuan; Tian, Juanhua; Wan, Ziyan; Wang, Zhenlong; Chong, Tie. Identification of key genes and functions of circulating tumor cells in multiple cancers through bioinformatic analysis. Bmc Medical Genomics. 2020;13(1):140. 

Liu, Yiwei; Chen, Hairong; Li, Xiangcheng; Zhang, Feng; Kong, Lianbao; Wang, Xuehao; Bai, Jin; Wu, Xiaofeng. PSMC2 Regulates Cell Cycle Progression Through the p21/Cyclin D1 Pathway and Predicts a Poor Prognosis in Human Hepatocellular Carcinoma. Frontiers In Oncology. 11( 33718159):607021. 

Mann, Melissa J; Flory, Ashley R; Oikonomou, Christina; Hayes, Candace A; Melendez-Suchi, Chris; Hendershot, Linda M. Identification of two rate-limiting steps in the degradation of partially folded immunoglobulin light chains. Frontiers In Cell And Developmental Biology. 10( 36072336):924848.