Anti PSMB9 pAb (ATL-HPA042818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042818-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PSMB9
Alternative Gene Name: beta1i, LMP2, PSMB6i, RING12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096727: 88%, ENSRNOG00000000459: 91%
Entrez Gene ID: 5698
Uniprot ID: P28065
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG |
| Gene Sequence | GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG |
| Gene ID - Mouse | ENSMUSG00000096727 |
| Gene ID - Rat | ENSRNOG00000000459 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMB9 pAb (ATL-HPA042818) | |
| Datasheet | Anti PSMB9 pAb (ATL-HPA042818) Datasheet (External Link) |
| Vendor Page | Anti PSMB9 pAb (ATL-HPA042818) at Atlas Antibodies |
| Documents & Links for Anti PSMB9 pAb (ATL-HPA042818) | |
| Datasheet | Anti PSMB9 pAb (ATL-HPA042818) Datasheet (External Link) |
| Vendor Page | Anti PSMB9 pAb (ATL-HPA042818) |