Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046995-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PSMB8
Alternative Gene Name: beta5i, D6S216E, LMP7, PSMB5i, RING10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024338: 82%, ENSRNOG00000000456: 88%
Entrez Gene ID: 5696
Uniprot ID: P28062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
Gene Sequence | GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
Gene ID - Mouse | ENSMUSG00000024338 |
Gene ID - Rat | ENSRNOG00000000456 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) | |
Datasheet | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) | |
Datasheet | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) |
Citations for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) – 1 Found |
Liew, Phui-Ly; Huang, Rui-Lan; Weng, Yu-Chun; Fang, Chia-Lang; Hui-Ming Huang, Tim; Lai, Hung-Cheng. Distinct methylation profile of mucinous ovarian carcinoma reveals susceptibility to proteasome inhibitors. International Journal Of Cancer. 2018;143(2):355-367. PubMed |