Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046995-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, beta type, 8
Gene Name: PSMB8
Alternative Gene Name: beta5i, D6S216E, LMP7, PSMB5i, RING10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024338: 82%, ENSRNOG00000000456: 88%
Entrez Gene ID: 5696
Uniprot ID: P28062
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Gene Sequence GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Gene ID - Mouse ENSMUSG00000024338
Gene ID - Rat ENSRNOG00000000456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)
Datasheet Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)
Datasheet Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation)
Citations for Anti PSMB8 pAb (ATL-HPA046995 w/enhanced validation) – 1 Found
Liew, Phui-Ly; Huang, Rui-Lan; Weng, Yu-Chun; Fang, Chia-Lang; Hui-Ming Huang, Tim; Lai, Hung-Cheng. Distinct methylation profile of mucinous ovarian carcinoma reveals susceptibility to proteasome inhibitors. International Journal Of Cancer. 2018;143(2):355-367.  PubMed