Anti PSMB7 pAb (ATL-HPA054902)

Atlas Antibodies

Catalog No.:
ATL-HPA054902-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proteasome subunit beta 7
Gene Name: PSMB7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 95%, ENSRNOG00000011732: 92%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM
Gene Sequence LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM
Gene ID - Mouse ENSMUSG00000026750
Gene ID - Rat ENSRNOG00000011732
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMB7 pAb (ATL-HPA054902)
Datasheet Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link)
Vendor Page Anti PSMB7 pAb (ATL-HPA054902) at Atlas Antibodies

Documents & Links for Anti PSMB7 pAb (ATL-HPA054902)
Datasheet Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link)
Vendor Page Anti PSMB7 pAb (ATL-HPA054902)