Anti PSMB7 pAb (ATL-HPA054902)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054902-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PSMB7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 95%, ENSRNOG00000011732: 92%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM |
| Gene Sequence | LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM |
| Gene ID - Mouse | ENSMUSG00000026750 |
| Gene ID - Rat | ENSRNOG00000011732 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMB7 pAb (ATL-HPA054902) | |
| Datasheet | Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link) |
| Vendor Page | Anti PSMB7 pAb (ATL-HPA054902) at Atlas Antibodies |
| Documents & Links for Anti PSMB7 pAb (ATL-HPA054902) | |
| Datasheet | Anti PSMB7 pAb (ATL-HPA054902) Datasheet (External Link) |
| Vendor Page | Anti PSMB7 pAb (ATL-HPA054902) |