Anti PSMB7 pAb (ATL-HPA052408)

Atlas Antibodies

Catalog No.:
ATL-HPA052408-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, beta type, 7
Gene Name: PSMB7
Alternative Gene Name: Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 100%, ENSRNOG00000011732: 100%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
Gene Sequence RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
Gene ID - Mouse ENSMUSG00000026750
Gene ID - Rat ENSRNOG00000011732
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMB7 pAb (ATL-HPA052408)
Datasheet Anti PSMB7 pAb (ATL-HPA052408) Datasheet (External Link)
Vendor Page Anti PSMB7 pAb (ATL-HPA052408) at Atlas Antibodies

Documents & Links for Anti PSMB7 pAb (ATL-HPA052408)
Datasheet Anti PSMB7 pAb (ATL-HPA052408) Datasheet (External Link)
Vendor Page Anti PSMB7 pAb (ATL-HPA052408)
Citations for Anti PSMB7 pAb (ATL-HPA052408) – 1 Found
Koehler, Sybille; Kuczkowski, Alexander; Kuehne, Lucas; Jüngst, Christian; Hoehne, Martin; Grahammer, Florian; Eddy, Sean; Kretzler, Matthias; Beck, Bodo B; Höhfeld, Jörg; Schermer, Bernhard; Benzing, Thomas; Brinkkoetter, Paul T; Rinschen, Markus M. Proteome Analysis of Isolated Podocytes Reveals Stress Responses in Glomerular Sclerosis. Journal Of The American Society Of Nephrology : Jasn. 2020;31(3):544-559.  PubMed