Anti PSMB7 pAb (ATL-HPA052408)

Atlas Antibodies

Catalog No.: ATL-HPA052408-25

Protein Description: proteasome (prosome, macropain) subunit, beta type, 7
Gene Name: PSMB7
Alternative Gene Name: Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026750: 100%, ENSRNOG00000011732: 100%
Entrez Gene ID: 5695
Uniprot ID: Q99436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
• Gene Sequence: RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA
• Gene ID - Mouse: ENSMUSG00000026750
• Gene ID - Rat: ENSRNOG00000011732
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMB7 pAb (ATL-HPA052408) – 1 Found

Koehler, Sybille; Kuczkowski, Alexander; Kuehne, Lucas; Jüngst, Christian; Hoehne, Martin; Grahammer, Florian; Eddy, Sean; Kretzler, Matthias; Beck, Bodo B; Höhfeld, Jörg; Schermer, Bernhard; Benzing, Thomas; Brinkkoetter, Paul T; Rinschen, Markus M. Proteome Analysis of Isolated Podocytes Reveals Stress Responses in Glomerular Sclerosis. Journal Of The American Society Of Nephrology : Jasn. 2020;31(3):544-559.