Anti PSMB6 pAb (ATL-HPA063656)
Atlas Antibodies
- SKU:
- ATL-HPA063656-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM |
Gene Sequence | SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM |
Gene ID - Mouse | ENSMUSG00000018286 |
Gene ID - Rat | ENSRNOG00000019551 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) at Atlas Antibodies |
Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) |