Anti PSMB6 pAb (ATL-HPA063656)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063656-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM |
| Gene Sequence | SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM |
| Gene ID - Mouse | ENSMUSG00000018286 |
| Gene ID - Rat | ENSRNOG00000019551 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
| Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
| Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) at Atlas Antibodies |
| Documents & Links for Anti PSMB6 pAb (ATL-HPA063656) | |
| Datasheet | Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link) |
| Vendor Page | Anti PSMB6 pAb (ATL-HPA063656) |