Anti PSMB6 pAb (ATL-HPA063656)

Atlas Antibodies

Catalog No.:
ATL-HPA063656-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: proteasome subunit beta 6
Gene Name: PSMB6
Alternative Gene Name: DELTA, Y
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018286: 100%, ENSRNOG00000019551: 100%
Entrez Gene ID: 5694
Uniprot ID: P28072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
Gene Sequence SIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPM
Gene ID - Mouse ENSMUSG00000018286
Gene ID - Rat ENSRNOG00000019551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMB6 pAb (ATL-HPA063656)
Datasheet Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link)
Vendor Page Anti PSMB6 pAb (ATL-HPA063656) at Atlas Antibodies

Documents & Links for Anti PSMB6 pAb (ATL-HPA063656)
Datasheet Anti PSMB6 pAb (ATL-HPA063656) Datasheet (External Link)
Vendor Page Anti PSMB6 pAb (ATL-HPA063656)