Anti PSMB4 pAb (ATL-HPA073499)
Atlas Antibodies
- SKU:
- ATL-HPA073499-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PSMB4
Alternative Gene Name: HN3, PROS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005779: 89%, ENSRNOG00000020979: 73%
Entrez Gene ID: 5692
Uniprot ID: P28070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA |
Gene Sequence | APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA |
Gene ID - Mouse | ENSMUSG00000005779 |
Gene ID - Rat | ENSRNOG00000020979 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMB4 pAb (ATL-HPA073499) | |
Datasheet | Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link) |
Vendor Page | Anti PSMB4 pAb (ATL-HPA073499) at Atlas Antibodies |
Documents & Links for Anti PSMB4 pAb (ATL-HPA073499) | |
Datasheet | Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link) |
Vendor Page | Anti PSMB4 pAb (ATL-HPA073499) |