Anti PSMB4 pAb (ATL-HPA073499)

Atlas Antibodies

Catalog No.:
ATL-HPA073499-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: proteasome subunit beta 4
Gene Name: PSMB4
Alternative Gene Name: HN3, PROS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005779: 89%, ENSRNOG00000020979: 73%
Entrez Gene ID: 5692
Uniprot ID: P28070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA
Gene Sequence APGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGA
Gene ID - Mouse ENSMUSG00000005779
Gene ID - Rat ENSRNOG00000020979
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSMB4 pAb (ATL-HPA073499)
Datasheet Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link)
Vendor Page Anti PSMB4 pAb (ATL-HPA073499) at Atlas Antibodies

Documents & Links for Anti PSMB4 pAb (ATL-HPA073499)
Datasheet Anti PSMB4 pAb (ATL-HPA073499) Datasheet (External Link)
Vendor Page Anti PSMB4 pAb (ATL-HPA073499)