Anti PSMB3 pAb (ATL-HPA048147)

Atlas Antibodies

SKU:
ATL-HPA048147-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proteasome (prosome, macropain) subunit, beta type, 3
Gene Name: PSMB3
Alternative Gene Name: HC10-II, MGC4147
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069744: 100%, ENSRNOG00000052730: 100%
Entrez Gene ID: 5691
Uniprot ID: P49720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVA
Gene Sequence AMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVA
Gene ID - Mouse ENSMUSG00000069744
Gene ID - Rat ENSRNOG00000052730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PSMB3 pAb (ATL-HPA048147)
Datasheet Anti PSMB3 pAb (ATL-HPA048147) Datasheet (External Link)
Vendor Page Anti PSMB3 pAb (ATL-HPA048147) at Atlas Antibodies

Documents & Links for Anti PSMB3 pAb (ATL-HPA048147)
Datasheet Anti PSMB3 pAb (ATL-HPA048147) Datasheet (External Link)
Vendor Page Anti PSMB3 pAb (ATL-HPA048147)