Anti PSMA5 pAb (ATL-HPA028441)

Atlas Antibodies

Catalog No.: ATL-HPA028441-25

Protein Description: proteasome (prosome, macropain) subunit, alpha type, 5
Gene Name: PSMA5
Alternative Gene Name: ZETA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068749: 100%, ENSRNOG00000019868: 100%
Entrez Gene ID: 5686
Uniprot ID: P28066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCD
• Gene Sequence: ARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCD
• Gene ID - Mouse: ENSMUSG00000068749
• Gene ID - Rat: ENSRNOG00000019868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.