Anti PSMA4 pAb (ATL-HPA055466)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055466-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PSMA4
Alternative Gene Name: HC9, HsT17706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032301: 100%, ENSRNOG00000013493: 100%
Entrez Gene ID: 5685
Uniprot ID: P25789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA |
Gene Sequence | MEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA |
Gene ID - Mouse | ENSMUSG00000032301 |
Gene ID - Rat | ENSRNOG00000013493 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PSMA4 pAb (ATL-HPA055466) | |
Datasheet | Anti PSMA4 pAb (ATL-HPA055466) Datasheet (External Link) |
Vendor Page | Anti PSMA4 pAb (ATL-HPA055466) at Atlas Antibodies |
Documents & Links for Anti PSMA4 pAb (ATL-HPA055466) | |
Datasheet | Anti PSMA4 pAb (ATL-HPA055466) Datasheet (External Link) |
Vendor Page | Anti PSMA4 pAb (ATL-HPA055466) |