Anti PSKH2 pAb (ATL-HPA015095 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015095-25

Protein Description: protein serine kinase H2
Gene Name: PSKH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048310: 62%, ENSRNOG00000019290: 62%
Entrez Gene ID: 85481
Uniprot ID: Q96QS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNLMQRASPHSQSPGSAQSSKSHYSHKSR
• Gene Sequence: SGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNLMQRASPHSQSPGSAQSSKSHYSHKSR
• Gene ID - Mouse: ENSMUSG00000048310
• Gene ID - Rat: ENSRNOG00000019290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.