Anti PSKH1 pAb (ATL-HPA062763)

Atlas Antibodies

Catalog No.:
ATL-HPA062763-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein serine kinase H1
Gene Name: PSKH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048310: 96%, ENSRNOG00000019290: 94%
Entrez Gene ID: 5681
Uniprot ID: P11801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAG
Gene Sequence MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAG
Gene ID - Mouse ENSMUSG00000048310
Gene ID - Rat ENSRNOG00000019290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSKH1 pAb (ATL-HPA062763)
Datasheet Anti PSKH1 pAb (ATL-HPA062763) Datasheet (External Link)
Vendor Page Anti PSKH1 pAb (ATL-HPA062763) at Atlas Antibodies

Documents & Links for Anti PSKH1 pAb (ATL-HPA062763)
Datasheet Anti PSKH1 pAb (ATL-HPA062763) Datasheet (External Link)
Vendor Page Anti PSKH1 pAb (ATL-HPA062763)