Anti PSEN1 pAb (ATL-HPA067496)

Atlas Antibodies

Catalog No.: ATL-HPA067496-25

Protein Description: presenilin 1
Gene Name: PSEN1
Alternative Gene Name: AD3, FAD, PS1, S182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019969: 74%, ENSRNOG00000009110: 73%
Entrez Gene ID: 5663
Uniprot ID: P49768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ
• Gene Sequence: MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ
• Gene ID - Mouse: ENSMUSG00000019969
• Gene ID - Rat: ENSRNOG00000009110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.