Anti PSD pAb (ATL-HPA059237)

Atlas Antibodies

Catalog No.:
ATL-HPA059237-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin and Sec7 domain containing
Gene Name: PSD
Alternative Gene Name: KIAA2011, PSD1, TYL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037126: 85%, ENSRNOG00000019435: 83%
Entrez Gene ID: 5662
Uniprot ID: A5PKW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWE
Gene Sequence LRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKWE
Gene ID - Mouse ENSMUSG00000037126
Gene ID - Rat ENSRNOG00000019435
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSD pAb (ATL-HPA059237)
Datasheet Anti PSD pAb (ATL-HPA059237) Datasheet (External Link)
Vendor Page Anti PSD pAb (ATL-HPA059237) at Atlas Antibodies

Documents & Links for Anti PSD pAb (ATL-HPA059237)
Datasheet Anti PSD pAb (ATL-HPA059237) Datasheet (External Link)
Vendor Page Anti PSD pAb (ATL-HPA059237)
Citations for Anti PSD pAb (ATL-HPA059237) – 1 Found
Ghosh, Mallika; Lo, Robin; Ivic, Ivan; Aguilera, Brian; Qendro, Veneta; Devarakonda, Charan; Shapiro, Linda H. CD13 tethers the IQGAP1-ARF6-EFA6 complex to the plasma membrane to promote ARF6 activation, β1 integrin recycling, and cell migration. Science Signaling. 2019;12(579)  PubMed