Anti PSAPL1 pAb (ATL-HPA038482)

Atlas Antibodies

Catalog No.:
ATL-HPA038482-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: prosaposin-like 1 (gene/pseudogene)
Gene Name: PSAPL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043430: 62%, ENSRNOG00000006845: 61%
Entrez Gene ID: 768239
Uniprot ID: Q6NUJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHN
Gene Sequence SITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHN
Gene ID - Mouse ENSMUSG00000043430
Gene ID - Rat ENSRNOG00000006845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSAPL1 pAb (ATL-HPA038482)
Datasheet Anti PSAPL1 pAb (ATL-HPA038482) Datasheet (External Link)
Vendor Page Anti PSAPL1 pAb (ATL-HPA038482) at Atlas Antibodies

Documents & Links for Anti PSAPL1 pAb (ATL-HPA038482)
Datasheet Anti PSAPL1 pAb (ATL-HPA038482) Datasheet (External Link)
Vendor Page Anti PSAPL1 pAb (ATL-HPA038482)