Anti PSAP pAb (ATL-HPA004426 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004426-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: prosaposin
Gene Name: PSAP
Alternative Gene Name: GLBA, SAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004207: 51%, ENSRNOG00000000571: 56%
Entrez Gene ID: 5660
Uniprot ID: P07602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
Gene Sequence TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
Gene ID - Mouse ENSMUSG00000004207
Gene ID - Rat ENSRNOG00000000571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation)
Datasheet Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation)
Datasheet Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PSAP pAb (ATL-HPA004426 w/enhanced validation)
Citations for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) – 3 Found
Valdez, Clarissa; Ysselstein, Daniel; Young, Tiffany J; Zheng, Jianbin; Krainc, Dimitri. Progranulin mutations result in impaired processing of prosaposin and reduced glucocerebrosidase activity. Human Molecular Genetics. 2020;29(5):716-726.  PubMed
He, Yachao; Zhang, Xiaoqun; Flais, Ivana; Svenningsson, Per. Decreased Prosaposin and Progranulin in the Cingulate Cortex Are Associated with Schizophrenia Pathophysiology. International Journal Of Molecular Sciences. 2022;23(19)  PubMed
Kojima, Rika; Zurbruegg, Mark; Li, Tianyi; Paslawski, Wojciech; Zhang, Xiaoqun; Svenningsson, Per. Prosaposin Reduces α-Synuclein in Cells and Saposin C Dislodges it from Glucosylceramide-enriched Lipid Membranes. Journal Of Molecular Neuroscience : Mn. 2022;72(11):2313-2325.  PubMed