Anti PSAP pAb (ATL-HPA004426 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004426-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PSAP
Alternative Gene Name: GLBA, SAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004207: 51%, ENSRNOG00000000571: 56%
Entrez Gene ID: 5660
Uniprot ID: P07602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE |
| Gene Sequence | TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE |
| Gene ID - Mouse | ENSMUSG00000004207 |
| Gene ID - Rat | ENSRNOG00000000571 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) | |
| Datasheet | Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) | |
| Datasheet | Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) |
| Citations for Anti PSAP pAb (ATL-HPA004426 w/enhanced validation) – 3 Found |
| Valdez, Clarissa; Ysselstein, Daniel; Young, Tiffany J; Zheng, Jianbin; Krainc, Dimitri. Progranulin mutations result in impaired processing of prosaposin and reduced glucocerebrosidase activity. Human Molecular Genetics. 2020;29(5):716-726. PubMed |
| He, Yachao; Zhang, Xiaoqun; Flais, Ivana; Svenningsson, Per. Decreased Prosaposin and Progranulin in the Cingulate Cortex Are Associated with Schizophrenia Pathophysiology. International Journal Of Molecular Sciences. 2022;23(19) PubMed |
| Kojima, Rika; Zurbruegg, Mark; Li, Tianyi; Paslawski, Wojciech; Zhang, Xiaoqun; Svenningsson, Per. Prosaposin Reduces α-Synuclein in Cells and Saposin C Dislodges it from Glucosylceramide-enriched Lipid Membranes. Journal Of Molecular Neuroscience : Mn. 2022;72(11):2313-2325. PubMed |