Anti PRY pAb (ATL-HPA046366)

Atlas Antibodies

Catalog No.:
ATL-HPA046366-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: PTPN13-like, Y-linked
Gene Name: PRY
Alternative Gene Name: PRY1, PTPN13LY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024998: 29%, ENSRNOG00000005568: 34%
Entrez Gene ID: 9081
Uniprot ID: O14603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLW
Gene Sequence ATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLW
Gene ID - Mouse ENSMUSG00000024998
Gene ID - Rat ENSRNOG00000005568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRY pAb (ATL-HPA046366)
Datasheet Anti PRY pAb (ATL-HPA046366) Datasheet (External Link)
Vendor Page Anti PRY pAb (ATL-HPA046366) at Atlas Antibodies

Documents & Links for Anti PRY pAb (ATL-HPA046366)
Datasheet Anti PRY pAb (ATL-HPA046366) Datasheet (External Link)
Vendor Page Anti PRY pAb (ATL-HPA046366)