Anti PRY pAb (ATL-HPA046366)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046366-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRY
Alternative Gene Name: PRY1, PTPN13LY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024998: 29%, ENSRNOG00000005568: 34%
Entrez Gene ID: 9081
Uniprot ID: O14603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLW |
Gene Sequence | ATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLW |
Gene ID - Mouse | ENSMUSG00000024998 |
Gene ID - Rat | ENSRNOG00000005568 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRY pAb (ATL-HPA046366) | |
Datasheet | Anti PRY pAb (ATL-HPA046366) Datasheet (External Link) |
Vendor Page | Anti PRY pAb (ATL-HPA046366) at Atlas Antibodies |
Documents & Links for Anti PRY pAb (ATL-HPA046366) | |
Datasheet | Anti PRY pAb (ATL-HPA046366) Datasheet (External Link) |
Vendor Page | Anti PRY pAb (ATL-HPA046366) |