Anti PRX pAb (ATL-HPA001868 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001868-25

Protein Description: periaxin
Gene Name: PRX
Alternative Gene Name: KIAA1620
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053198: 73%, ENSRNOG00000018369: 68%
Entrez Gene ID: 57716
Uniprot ID: Q9BXM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL
• Gene Sequence: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL
• Gene ID - Mouse: ENSMUSG00000053198
• Gene ID - Rat: ENSRNOG00000018369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRX pAb (ATL-HPA001868 w/enhanced validation) – 12 Found

Kegler, Kristel; Spitzbarth, Ingo; Imbschweiler, Ilka; Wewetzer, Konstantin; Baumgärtner, Wolfgang; Seehusen, Frauke. Contribution of Schwann Cells to Remyelination in a Naturally Occurring Canine Model of CNS Neuroinflammation. Plos One. 10(7):e0133916. 

Pye, Ruth J; Pemberton, David; Tovar, Cesar; Tubio, Jose M C; Dun, Karen A; Fox, Samantha; Darby, Jocelyn; Hayes, Dane; Knowles, Graeme W; Kreiss, Alexandre; Siddle, Hannah V T; Swift, Kate; Lyons, A Bruce; Murchison, Elizabeth P; Woods, Gregory M. A second transmissible cancer in Tasmanian devils. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(2):374-9. 

Spitzbarth, Ingo; Lempp, Charlotte; Kegler, Kristel; Ulrich, Reiner; Kalkuhl, Arno; Deschl, Ulrich; Baumgärtner, Wolfgang; Seehusen, Frauke. Immunohistochemical and transcriptome analyses indicate complex breakdown of axonal transport mechanisms in canine distemper leukoencephalitis. Brain And Behavior. 2016;6(7):e00472. 

Tovar, Cesar; Pye, Ruth J; Kreiss, Alexandre; Cheng, Yuanyuan; Brown, Gabriella K; Darby, Jocelyn; Malley, Roslyn C; Siddle, Hannah V T; Skjødt, Karsten; Kaufman, Jim; Silva, Anabel; Baz Morelli, Adriana; Papenfuss, Anthony T; Corcoran, Lynn M; Murphy, James M; Pearse, Martin J; Belov, Katherine; Lyons, A Bruce; Woods, Gregory M. Regression of devil facial tumour disease following immunotherapy in immunised Tasmanian devils. Scientific Reports. 2017;7( 28276463):43827. 

Tongtako, W; Lehmbecker, A; Wang, Y; Hahn, K; Baumgärtner, W; Gerhauser, I. Canine dorsal root ganglia satellite glial cells represent an exceptional cell population with astrocytic and oligodendrocytic properties. Scientific Reports. 2017;7(1):13915. 

Leitzen, Eva; Raddatz, Barbara B; Jin, Wen; Goebbels, Sandra; Nave, Klaus-Armin; Baumgärtner, Wolfgang; Hansmann, Florian. Virus-triggered spinal cord demyelination is followed by a peripheral neuropathy resembling features of Guillain-Barré Syndrome. Scientific Reports. 2019;9(1):4588. 

Hülskötter, Kirsten; Jin, Wen; Allnoch, Lisa; Hansmann, Florian; Schmidtke, Daniel; Rohn, Karl; Flügel, Alexander; Lühder, Fred; Baumgärtner, Wolfgang; Herder, Vanessa. Double-edged effects of tamoxifen-in-oil-gavage on an infectious murine model for multiple sclerosis. Brain Pathology (Zurich, Switzerland). 2021;31(6):e12994. 

Fadda, A; Bärtschi, M; Hemphill, A; Widmer, H R; Zurbriggen, A; Perona, P; Vidondo, B; Oevermann, A. Primary Postnatal Dorsal Root Ganglion Culture from Conventionally Slaughtered Calves. Plos One. 11(12):e0168228. 

Stammnitz, Maximilian R; Coorens, Tim H H; Gori, Kevin C; Hayes, Dane; Fu, Beiyuan; Wang, Jinhong; Martin-Herranz, Daniel E; Alexandrov, Ludmil B; Baez-Ortega, Adrian; Barthorpe, Syd; Beck, Alexandra; Giordano, Francesca; Knowles, Graeme W; Kwon, Young Mi; Hall, George; Price, Stacey; Pye, Ruth J; Tubio, Jose M C; Siddle, Hannah V T; Sohal, Sukhwinder Singh; Woods, Gregory M; McDermott, Ultan; Yang, Fengtang; Garnett, Mathew J; Ning, Zemin; Murchison, Elizabeth P. The Origins and Vulnerabilities of Two Transmissible Cancers in Tasmanian Devils. Cancer Cell. 2018;33(4):607-619.e15. 

Kosack, Lindsay; Wingelhofer, Bettina; Popa, Alexandra; Orlova, Anna; Agerer, Benedikt; Vilagos, Bojan; Majek, Peter; Parapatics, Katja; Lercher, Alexander; Ringler, Anna; Klughammer, Johanna; Smyth, Mark; Khamina, Kseniya; Baazim, Hatoon; de Araujo, Elvin D; Rosa, David A; Park, Jisung; Tin, Gary; Ahmar, Siawash; Gunning, Patrick T; Bock, Christoph; Siddle, Hannah V; Woods, Gregory M; Kubicek, Stefan; Murchison, Elizabeth P; Bennett, Keiryn L; Moriggl, Richard; Bergthaler, Andreas. The ERBB-STAT3 Axis Drives Tasmanian Devil Facial Tumor Disease. Cancer Cell. 2019;35(1):125-139.e9. 

Huang, Bei; Zdora, Isabel; de Buhr, Nicole; Lehmbecker, Annika; Baumgärtner, Wolfgang; Leitzen, Eva. Phenotypical peculiarities and species-specific differences of canine and murine satellite glial cells of spinal ganglia. Journal Of Cellular And Molecular Medicine. 2021;25(14):6909-6924. 

Huang, Bei; Zdora, Isabel; de Buhr, Nicole; Eikelberg, Deborah; Baumgärtner, Wolfgang; Leitzen, Eva. Phenotypical changes of satellite glial cells in a murine model of G(M1) -gangliosidosis. Journal Of Cellular And Molecular Medicine. 2022;26(2):527-539.