Anti PRTFDC1 pAb (ATL-HPA021458)

Atlas Antibodies

Catalog No.: ATL-HPA021458-25

Protein Description: phosphoribosyl transferase domain containing 1
Gene Name: PRTFDC1
Alternative Gene Name: HHGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025630: 54%, ENSRNOG00000024874: 89%
Entrez Gene ID: 56952
Uniprot ID: Q9NRG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLA
• Gene Sequence: MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLA
• Gene ID - Mouse: ENSMUSG00000025630
• Gene ID - Rat: ENSRNOG00000024874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.