Anti PRSS48 pAb (ATL-HPA053801)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053801-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRSS48
Alternative Gene Name: ESSPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032493: 25%, ENSRNOG00000024208: 36%
Entrez Gene ID: 345062
Uniprot ID: Q7RTY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRPSCAFGPNTIHRVGTVAEAVACIQGWEENAWRFSPR |
Gene Sequence | GVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRPSCAFGPNTIHRVGTVAEAVACIQGWEENAWRFSPR |
Gene ID - Mouse | ENSMUSG00000032493 |
Gene ID - Rat | ENSRNOG00000024208 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRSS48 pAb (ATL-HPA053801) | |
Datasheet | Anti PRSS48 pAb (ATL-HPA053801) Datasheet (External Link) |
Vendor Page | Anti PRSS48 pAb (ATL-HPA053801) at Atlas Antibodies |
Documents & Links for Anti PRSS48 pAb (ATL-HPA053801) | |
Datasheet | Anti PRSS48 pAb (ATL-HPA053801) Datasheet (External Link) |
Vendor Page | Anti PRSS48 pAb (ATL-HPA053801) |