Anti PRSS48 pAb (ATL-HPA053801)

Atlas Antibodies

Catalog No.:
ATL-HPA053801-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protease, serine, 48
Gene Name: PRSS48
Alternative Gene Name: ESSPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032493: 25%, ENSRNOG00000024208: 36%
Entrez Gene ID: 345062
Uniprot ID: Q7RTY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRPSCAFGPNTIHRVGTVAEAVACIQGWEENAWRFSPR
Gene Sequence GVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRPSCAFGPNTIHRVGTVAEAVACIQGWEENAWRFSPR
Gene ID - Mouse ENSMUSG00000032493
Gene ID - Rat ENSRNOG00000024208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS48 pAb (ATL-HPA053801)
Datasheet Anti PRSS48 pAb (ATL-HPA053801) Datasheet (External Link)
Vendor Page Anti PRSS48 pAb (ATL-HPA053801) at Atlas Antibodies

Documents & Links for Anti PRSS48 pAb (ATL-HPA053801)
Datasheet Anti PRSS48 pAb (ATL-HPA053801) Datasheet (External Link)
Vendor Page Anti PRSS48 pAb (ATL-HPA053801)