Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA020541-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protease, serine, 37
Gene Name: PRSS37
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029909: 84%, ENSRNOG00000012201: 82%
Entrez Gene ID: 136242
Uniprot ID: A4D1T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC
Gene Sequence PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC
Gene ID - Mouse ENSMUSG00000029909
Gene ID - Rat ENSRNOG00000012201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation)
Datasheet Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation)
Datasheet Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation)
Citations for Anti PRSS37 pAb (ATL-HPA020541 w/enhanced validation) – 1 Found
Shang, Xuan; Shen, Chunling; Liu, Jianbing; Tang, Lingyun; Zhang, Hongxin; Wang, Yicheng; Wu, Wenting; Chi, Jun; Zhuang, Hua; Fei, Jian; Wang, Zhugang. Serine protease PRSS55 is crucial for male mouse fertility via affecting sperm migration and sperm-egg binding. Cellular And Molecular Life Sciences : Cmls. 2018;75(23):4371-4384.  PubMed