Anti PRSS22 pAb (ATL-HPA049161)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049161-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PRSS22
Alternative Gene Name: BSSP-4, hBSSP-4, SP001LA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045027: 80%, ENSRNOG00000039698: 80%
Entrez Gene ID: 64063
Uniprot ID: Q9GZN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV |
Gene Sequence | AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV |
Gene ID - Mouse | ENSMUSG00000045027 |
Gene ID - Rat | ENSRNOG00000039698 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRSS22 pAb (ATL-HPA049161) | |
Datasheet | Anti PRSS22 pAb (ATL-HPA049161) Datasheet (External Link) |
Vendor Page | Anti PRSS22 pAb (ATL-HPA049161) at Atlas Antibodies |
Documents & Links for Anti PRSS22 pAb (ATL-HPA049161) | |
Datasheet | Anti PRSS22 pAb (ATL-HPA049161) Datasheet (External Link) |
Vendor Page | Anti PRSS22 pAb (ATL-HPA049161) |