Anti PRSS22 pAb (ATL-HPA049161)

Atlas Antibodies

Catalog No.:
ATL-HPA049161-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protease, serine, 22
Gene Name: PRSS22
Alternative Gene Name: BSSP-4, hBSSP-4, SP001LA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045027: 80%, ENSRNOG00000039698: 80%
Entrez Gene ID: 64063
Uniprot ID: Q9GZN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV
Gene Sequence AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV
Gene ID - Mouse ENSMUSG00000045027
Gene ID - Rat ENSRNOG00000039698
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRSS22 pAb (ATL-HPA049161)
Datasheet Anti PRSS22 pAb (ATL-HPA049161) Datasheet (External Link)
Vendor Page Anti PRSS22 pAb (ATL-HPA049161) at Atlas Antibodies

Documents & Links for Anti PRSS22 pAb (ATL-HPA049161)
Datasheet Anti PRSS22 pAb (ATL-HPA049161) Datasheet (External Link)
Vendor Page Anti PRSS22 pAb (ATL-HPA049161)