Anti PRRX2 pAb (ATL-HPA026808)

Atlas Antibodies

Catalog No.: ATL-HPA026808-25

Protein Description: paired related homeobox 2
Gene Name: PRRX2
Alternative Gene Name: PMX2, PRX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039476: 92%, ENSRNOG00000058329: 93%
Entrez Gene ID: 51450
Uniprot ID: Q99811
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
• Gene Sequence: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
• Gene ID - Mouse: ENSMUSG00000039476
• Gene ID - Rat: ENSRNOG00000058329
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRRX2 pAb (ATL-HPA026808) – 1 Found

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933.