Anti PRRX1 pAb (ATL-HPA063566)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063566-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRRX1
Alternative Gene Name: PHOX1, PMX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026586: 100%, ENSRNOG00000003720: 100%
Entrez Gene ID: 5396
Uniprot ID: P54821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE |
| Gene Sequence | NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE |
| Gene ID - Mouse | ENSMUSG00000026586 |
| Gene ID - Rat | ENSRNOG00000003720 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRRX1 pAb (ATL-HPA063566) | |
| Datasheet | Anti PRRX1 pAb (ATL-HPA063566) Datasheet (External Link) |
| Vendor Page | Anti PRRX1 pAb (ATL-HPA063566) at Atlas Antibodies |
| Documents & Links for Anti PRRX1 pAb (ATL-HPA063566) | |
| Datasheet | Anti PRRX1 pAb (ATL-HPA063566) Datasheet (External Link) |
| Vendor Page | Anti PRRX1 pAb (ATL-HPA063566) |