Anti PRRX1 pAb (ATL-HPA063566)

Atlas Antibodies

Catalog No.: ATL-HPA063566-25

Protein Description: paired related homeobox 1
Gene Name: PRRX1
Alternative Gene Name: PHOX1, PMX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026586: 100%, ENSRNOG00000003720: 100%
Entrez Gene ID: 5396
Uniprot ID: P54821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
• Gene Sequence: NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
• Gene ID - Mouse: ENSMUSG00000026586
• Gene ID - Rat: ENSRNOG00000003720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.