Anti PRRX1 pAb (ATL-HPA063566)

Atlas Antibodies

Catalog No.:
ATL-HPA063566-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: paired related homeobox 1
Gene Name: PRRX1
Alternative Gene Name: PHOX1, PMX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026586: 100%, ENSRNOG00000003720: 100%
Entrez Gene ID: 5396
Uniprot ID: P54821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
Gene Sequence NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
Gene ID - Mouse ENSMUSG00000026586
Gene ID - Rat ENSRNOG00000003720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRX1 pAb (ATL-HPA063566)
Datasheet Anti PRRX1 pAb (ATL-HPA063566) Datasheet (External Link)
Vendor Page Anti PRRX1 pAb (ATL-HPA063566) at Atlas Antibodies

Documents & Links for Anti PRRX1 pAb (ATL-HPA063566)
Datasheet Anti PRRX1 pAb (ATL-HPA063566) Datasheet (External Link)
Vendor Page Anti PRRX1 pAb (ATL-HPA063566)