Anti PRRT4 pAb (ATL-HPA052681)

Atlas Antibodies

Catalog No.:
ATL-HPA052681-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline-rich transmembrane protein 4
Gene Name: PRRT4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079654: 88%, ENSRNOG00000039388: 89%
Entrez Gene ID: 401399
Uniprot ID: C9JH25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRRSTVTWDTALMVTALPSSAPRPHQSELELKFDMALRAGAAPTLGHRTLPLLPSLRASLAEIAGRLGPFGFFGTTLSPL
Gene Sequence PRRSTVTWDTALMVTALPSSAPRPHQSELELKFDMALRAGAAPTLGHRTLPLLPSLRASLAEIAGRLGPFGFFGTTLSPL
Gene ID - Mouse ENSMUSG00000079654
Gene ID - Rat ENSRNOG00000039388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRT4 pAb (ATL-HPA052681)
Datasheet Anti PRRT4 pAb (ATL-HPA052681) Datasheet (External Link)
Vendor Page Anti PRRT4 pAb (ATL-HPA052681) at Atlas Antibodies

Documents & Links for Anti PRRT4 pAb (ATL-HPA052681)
Datasheet Anti PRRT4 pAb (ATL-HPA052681) Datasheet (External Link)
Vendor Page Anti PRRT4 pAb (ATL-HPA052681)