Anti PRRT4 pAb (ATL-HPA046373)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046373-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PRRT4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079654: 82%, ENSRNOG00000039388: 81%
Entrez Gene ID: 401399
Uniprot ID: C9JH25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS |
Gene Sequence | PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS |
Gene ID - Mouse | ENSMUSG00000079654 |
Gene ID - Rat | ENSRNOG00000039388 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PRRT4 pAb (ATL-HPA046373) | |
Datasheet | Anti PRRT4 pAb (ATL-HPA046373) Datasheet (External Link) |
Vendor Page | Anti PRRT4 pAb (ATL-HPA046373) at Atlas Antibodies |
Documents & Links for Anti PRRT4 pAb (ATL-HPA046373) | |
Datasheet | Anti PRRT4 pAb (ATL-HPA046373) Datasheet (External Link) |
Vendor Page | Anti PRRT4 pAb (ATL-HPA046373) |