Anti PRRT4 pAb (ATL-HPA046373)

Atlas Antibodies

Catalog No.: ATL-HPA046373-25

Protein Description: proline-rich transmembrane protein 4
Gene Name: PRRT4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079654: 82%, ENSRNOG00000039388: 81%
Entrez Gene ID: 401399
Uniprot ID: C9JH25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
• Gene Sequence: PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
• Gene ID - Mouse: ENSMUSG00000079654
• Gene ID - Rat: ENSRNOG00000039388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.