Anti PRRT1 pAb (ATL-HPA055149)

Atlas Antibodies

Catalog No.:
ATL-HPA055149-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: proline-rich transmembrane protein 1
Gene Name: PRRT1
Alternative Gene Name: C6orf31, IFITMD7, NG5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015476: 95%, ENSRNOG00000000433: 94%
Entrez Gene ID: 80863
Uniprot ID: Q99946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
Gene Sequence PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
Gene ID - Mouse ENSMUSG00000015476
Gene ID - Rat ENSRNOG00000000433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRT1 pAb (ATL-HPA055149)
Datasheet Anti PRRT1 pAb (ATL-HPA055149) Datasheet (External Link)
Vendor Page Anti PRRT1 pAb (ATL-HPA055149) at Atlas Antibodies

Documents & Links for Anti PRRT1 pAb (ATL-HPA055149)
Datasheet Anti PRRT1 pAb (ATL-HPA055149) Datasheet (External Link)
Vendor Page Anti PRRT1 pAb (ATL-HPA055149)