Anti PRRG4 pAb (ATL-HPA009040)

Atlas Antibodies

Catalog No.: ATL-HPA009040-25

Protein Description: proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane)
Gene Name: PRRG4
Alternative Gene Name: TMG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027171: 76%, ENSRNOG00000022710: 80%
Entrez Gene ID: 79056
Uniprot ID: Q9BZD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
• Gene Sequence: NRLQHPCSSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHSVSPPPPYPGHTKGFRVFKKSMSLPSH
• Gene ID - Mouse: ENSMUSG00000027171
• Gene ID - Rat: ENSRNOG00000022710
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRRG4 pAb (ATL-HPA009040) – 1 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.