Anti PRRG3 pAb (ATL-HPA060566)

Atlas Antibodies

Catalog No.:
ATL-HPA060566-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)
Gene Name: PRRG3
Alternative Gene Name: TMG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033361: 100%, ENSRNOG00000045663: 100%
Entrez Gene ID: 79057
Uniprot ID: Q9BZD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY
Gene Sequence EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY
Gene ID - Mouse ENSMUSG00000033361
Gene ID - Rat ENSRNOG00000045663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRG3 pAb (ATL-HPA060566)
Datasheet Anti PRRG3 pAb (ATL-HPA060566) Datasheet (External Link)
Vendor Page Anti PRRG3 pAb (ATL-HPA060566) at Atlas Antibodies

Documents & Links for Anti PRRG3 pAb (ATL-HPA060566)
Datasheet Anti PRRG3 pAb (ATL-HPA060566) Datasheet (External Link)
Vendor Page Anti PRRG3 pAb (ATL-HPA060566)