Anti PRRC2C pAb (ATL-HPA028659)

Atlas Antibodies

Catalog No.:
ATL-HPA028659-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline-rich coiled-coil 2C
Gene Name: PRRC2C
Alternative Gene Name: BAT2D1, BAT2L2, KIAA1096, XTP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040225: 84%, ENSRNOG00000008949: 30%
Entrez Gene ID: 23215
Uniprot ID: Q9Y520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTSQSSKQPPPSIRLPSAQTPNGTDYVASGKSIQTPQSHGTLTAELWDNKVAPPAVLNDISKKLGPISPPQPPSVSAWNKPLTSFGSAP
Gene Sequence TTSQSSKQPPPSIRLPSAQTPNGTDYVASGKSIQTPQSHGTLTAELWDNKVAPPAVLNDISKKLGPISPPQPPSVSAWNKPLTSFGSAP
Gene ID - Mouse ENSMUSG00000040225
Gene ID - Rat ENSRNOG00000008949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRC2C pAb (ATL-HPA028659)
Datasheet Anti PRRC2C pAb (ATL-HPA028659) Datasheet (External Link)
Vendor Page Anti PRRC2C pAb (ATL-HPA028659) at Atlas Antibodies

Documents & Links for Anti PRRC2C pAb (ATL-HPA028659)
Datasheet Anti PRRC2C pAb (ATL-HPA028659) Datasheet (External Link)
Vendor Page Anti PRRC2C pAb (ATL-HPA028659)