Anti PRRC2C pAb (ATL-HPA025766)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025766-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PRRC2C
Alternative Gene Name: BAT2D1, BAT2L2, KIAA1096, XTP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040225: 68%, ENSRNOG00000016256: 27%
Entrez Gene ID: 23215
Uniprot ID: Q9Y520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP |
| Gene Sequence | DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP |
| Gene ID - Mouse | ENSMUSG00000040225 |
| Gene ID - Rat | ENSRNOG00000016256 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRRC2C pAb (ATL-HPA025766) | |
| Datasheet | Anti PRRC2C pAb (ATL-HPA025766) Datasheet (External Link) |
| Vendor Page | Anti PRRC2C pAb (ATL-HPA025766) at Atlas Antibodies |
| Documents & Links for Anti PRRC2C pAb (ATL-HPA025766) | |
| Datasheet | Anti PRRC2C pAb (ATL-HPA025766) Datasheet (External Link) |
| Vendor Page | Anti PRRC2C pAb (ATL-HPA025766) |