Anti PRRC2C pAb (ATL-HPA025766)

Atlas Antibodies

Catalog No.: ATL-HPA025766-25

Protein Description: proline-rich coiled-coil 2C
Gene Name: PRRC2C
Alternative Gene Name: BAT2D1, BAT2L2, KIAA1096, XTP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040225: 68%, ENSRNOG00000016256: 27%
Entrez Gene ID: 23215
Uniprot ID: Q9Y520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP
• Gene Sequence: DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP
• Gene ID - Mouse: ENSMUSG00000040225
• Gene ID - Rat: ENSRNOG00000016256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.