Anti PRRC1 pAb (ATL-HPA039212)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039212-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PRRC1
Alternative Gene Name: FLJ32875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024594: 98%, ENSRNOG00000016433: 98%
Entrez Gene ID: 133619
Uniprot ID: Q96M27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH |
| Gene Sequence | AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH |
| Gene ID - Mouse | ENSMUSG00000024594 |
| Gene ID - Rat | ENSRNOG00000016433 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PRRC1 pAb (ATL-HPA039212) | |
| Datasheet | Anti PRRC1 pAb (ATL-HPA039212) Datasheet (External Link) |
| Vendor Page | Anti PRRC1 pAb (ATL-HPA039212) at Atlas Antibodies |
| Documents & Links for Anti PRRC1 pAb (ATL-HPA039212) | |
| Datasheet | Anti PRRC1 pAb (ATL-HPA039212) Datasheet (External Link) |
| Vendor Page | Anti PRRC1 pAb (ATL-HPA039212) |