Anti PRRC1 pAb (ATL-HPA039212)

Atlas Antibodies

Catalog No.:
ATL-HPA039212-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline-rich coiled-coil 1
Gene Name: PRRC1
Alternative Gene Name: FLJ32875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024594: 98%, ENSRNOG00000016433: 98%
Entrez Gene ID: 133619
Uniprot ID: Q96M27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH
Gene Sequence AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH
Gene ID - Mouse ENSMUSG00000024594
Gene ID - Rat ENSRNOG00000016433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRC1 pAb (ATL-HPA039212)
Datasheet Anti PRRC1 pAb (ATL-HPA039212) Datasheet (External Link)
Vendor Page Anti PRRC1 pAb (ATL-HPA039212) at Atlas Antibodies

Documents & Links for Anti PRRC1 pAb (ATL-HPA039212)
Datasheet Anti PRRC1 pAb (ATL-HPA039212) Datasheet (External Link)
Vendor Page Anti PRRC1 pAb (ATL-HPA039212)