Anti PRR9 pAb (ATL-HPA027714)

Atlas Antibodies

Catalog No.:
ATL-HPA027714-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proline rich 9
Gene Name: PRR9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056270: 76%, ENSRNOG00000012312: 69%
Entrez Gene ID: 574414
Uniprot ID: Q5T870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPG
Gene Sequence QCQAKAEEVCLPTCQHPCQDKCLVQAQEVCLSQCQESSQEKCPQQGQEPYLPPCQDQCPPQCAEPCQELFQTKCVEVCPQKVQEKCSSPG
Gene ID - Mouse ENSMUSG00000056270
Gene ID - Rat ENSRNOG00000012312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRR9 pAb (ATL-HPA027714)
Datasheet Anti PRR9 pAb (ATL-HPA027714) Datasheet (External Link)
Vendor Page Anti PRR9 pAb (ATL-HPA027714) at Atlas Antibodies

Documents & Links for Anti PRR9 pAb (ATL-HPA027714)
Datasheet Anti PRR9 pAb (ATL-HPA027714) Datasheet (External Link)
Vendor Page Anti PRR9 pAb (ATL-HPA027714)